SPATA6 Antikörper (Middle Region)
-
- Target Alle SPATA6 Antikörper anzeigen
- SPATA6 (Spermatogenesis Associated 6 (SPATA6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPATA6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SPATA6 antibody was raised against the middle region of SPATA6
- Aufreinigung
- Affinity purified
- Immunogen
- SPATA6 antibody was raised using the middle region of SPATA6 corresponding to a region with amino acids SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR
- Top Product
- Discover our top product SPATA6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPATA6 Blocking Peptide, catalog no. 33R-8715, is also available for use as a blocking control in assays to test for specificity of this SPATA6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPATA6 (Spermatogenesis Associated 6 (SPATA6))
- Andere Bezeichnung
- SPATA6 (SPATA6 Produkte)
- Synonyme
- HASH antikoerper, SRF-1 antikoerper, SRF1 antikoerper, 1700062C23Rik antikoerper, AI790763 antikoerper, Hash antikoerper, KRP antikoerper, Mash antikoerper, spermatogenesis associated 6 antikoerper, SPATA6 antikoerper, Spata6 antikoerper
- Hintergrund
- SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.
- Molekulargewicht
- 54 kDa (MW of target protein)
-