TCP11 Antikörper
-
- Target Alle TCP11 Antikörper anzeigen
- TCP11 (T-Complex 11, Testis-Specific (TCP11))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TCP11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL
- Top Product
- Discover our top product TCP11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TCP11 Blocking Peptide, catalog no. 33R-1827, is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCP11 (T-Complex 11, Testis-Specific (TCP11))
- Andere Bezeichnung
- TCP11 (TCP11 Produkte)
- Synonyme
- D6S230E antikoerper, FPPR antikoerper, D17Ken1 antikoerper, Tcp-11 antikoerper, t-complex 11 antikoerper, t-complex protein 11 antikoerper, Tcp11 antikoerper, TCP11 antikoerper
- Hintergrund
- TCP11 may play an important role in sperm function and fertility.
- Molekulargewicht
- 49 kDa (MW of target protein)
-