HSPA4L Antikörper (C-Term)

Produktnummer ABIN632518

Produktdetails anti-HSPA4L Antikörper

Target: HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA4L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSPA4 L antibody was raised against the C terminal of HSPA4

Aufreinigung: Affinity purified

Immunogen: HSPA4 L antibody was raised using the C terminal of HSPA4 corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA4L Blocking Peptide, catalog no. 33R-4284, is also available for use as a blocking control in assays to test for specificity of this HSPA4L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA4L

Target: HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))

Andere Bezeichnung: HSPA4L (HSPA4L Produkte)

Synonyme: APG-1 antikoerper, HSPH3 antikoerper, Osp94 antikoerper, 94kDa antikoerper, AI461691 antikoerper, OSP94 antikoerper, heat shock protein family A (Hsp70) member 4 like antikoerper, heat shock protein 4 like antikoerper, HSPA4L antikoerper, Hspa4l antikoerper

Hintergrund: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Molekulargewicht: 92 kDa (MW of target protein)