TGM3 Antikörper
-
- Target Alle TGM3 Antikörper anzeigen
- TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TGM3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS
- Top Product
- Discover our top product TGM3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Transglutaminase 3 Blocking Peptide, catalog no. 33R-5600, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))
- Andere Bezeichnung
- Transglutaminase 3 (TGM3 Produkte)
- Synonyme
- TGE antikoerper, TG(E) antikoerper, AI893889 antikoerper, RGD1561831 antikoerper, transglutaminase 3 antikoerper, transglutaminase 3, E polypeptide antikoerper, TGM3 antikoerper, Tgm3 antikoerper
- Hintergrund
- Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds.
- Molekulargewicht
- 25 kDa (MW of target protein)
-