TGM3 Antikörper

Produktnummer ABIN632498

Der Kaninchen Polyklonal anti-TGM3 Antikörper wird verwendet zum Nachweis von TGM3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TGM3 Antikörper (ABIN632498)

Target: TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TGM3 Antikörper

Aufreinigung: Affinity purified

Immunogen: Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Transglutaminase 3 Blocking Peptide, (ABIN5616759), is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGM3

Target: TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))

Andere Bezeichnung: Transglutaminase 3

Hintergrund: Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds.

Molekulargewicht: 25 kDa (MW of target protein)