TGM4 Antikörper

Produktnummer ABIN632497

Produktdetails anti-TGM4 Antikörper

Target: TGM4 (Transglutaminase 4 (Prostate) (TGM4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGM4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Transglutaminase 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Transglutaminase 4 Blocking Peptide, catalog no. 33R-4320, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGM4

Target: TGM4 (Transglutaminase 4 (Prostate) (TGM4))

Andere Bezeichnung: Transglutaminase 4 (TGM4 Produkte)

Synonyme: LOC100227373 antikoerper, TGP antikoerper, hTGP antikoerper, 9530008N10Rik antikoerper, Eapa1 antikoerper, Dp1 antikoerper, transglutaminase 4 antikoerper, transglutaminase 4 (prostate) antikoerper, TGM4 antikoerper, Tgm4 antikoerper

Hintergrund: TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.

Molekulargewicht: 77 kDa (MW of target protein)