ACP5 Antikörper (N-Term)

Produktnummer ABIN632484

Produktdetails anti-ACP5 Antikörper

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACP5 antibody was raised against the N terminal of ACP5

Aufreinigung: Affinity purified

Immunogen: ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP5 Blocking Peptide, catalog no. 33R-2079, is also available for use as a blocking control in assays to test for specificity of this ACP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP5

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Andere Bezeichnung: ACP5 (ACP5 Produkte)

Synonyme: SPENCDI antikoerper, TRAP antikoerper, acp5 antikoerper, sb:cb576 antikoerper, zgc:63825 antikoerper, wu:fb19f01 antikoerper, wu:fb30b03 antikoerper, wu:fi14e01 antikoerper, wu:fj66f03 antikoerper, MGC78938 antikoerper, MGC89674 antikoerper, TR-AP antikoerper, zgc:92339 antikoerper, TRACP antikoerper, TTRRAP antikoerper, Trap antikoerper, UF antikoerper, acid phosphatase 5, tartrate resistant antikoerper, acid phosphatase 5a, tartrate resistant antikoerper, acid phosphatase 5, tartrate resistant S homeolog antikoerper, tartrate resistant acid phosphatase antikoerper, Tartrate-resistant acid phosphatase type 5 antikoerper, tartrate-resistant acid phosphatase type 5 antikoerper, acid phosphatase 5b, tartrate resistant antikoerper, ACP5 antikoerper, acp5a antikoerper, acp5.S antikoerper, acp5 antikoerper, NAEGRDRAFT_81291 antikoerper, ppa5 antikoerper, LOC100282899 antikoerper, acp5b antikoerper, Acp5 antikoerper

Hintergrund: This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis