CST8 Antikörper

Produktnummer ABIN632480

Produktdetails anti-CST8 Antikörper

Target: CST8 (Cystatin 8 (CST8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CST8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Cystatin 8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cystatin 8 Blocking Peptide, catalog no. 33R-5097, is also available for use as a blocking control in assays to test for specificity of this Cystatin 8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CST8

Target: CST8 (Cystatin 8 (CST8))

Andere Bezeichnung: Cystatin 8 (CST8 Produkte)

Synonyme: CRES antikoerper, CTES5 antikoerper, Cres antikoerper, Cst-rs1 antikoerper, cystatin 8 antikoerper, cystatin 8 (cystatin-related epididymal spermatogenic) antikoerper, CST8 antikoerper, Cst8 antikoerper

Hintergrund: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens.

Molekulargewicht: 14 kDa (MW of target protein)