KCTD9 Antikörper (Middle Region)

Produktnummer ABIN632479

Produktdetails anti-KCTD9 Antikörper

Target: KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD9 antibody was raised against the middle region of KCTD9

Aufreinigung: Affinity purified

Immunogen: KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD9 Blocking Peptide, catalog no. 33R-1239, is also available for use as a blocking control in assays to test for specificity of this KCTD9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD9

Target: KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))

Andere Bezeichnung: KCTD9 (KCTD9 Produkte)

Synonyme: zgc:101020 antikoerper, KCTD9 antikoerper, MGC159927 antikoerper, kctd9 antikoerper, AA675328 antikoerper, AI854539 antikoerper, BTBD27 antikoerper, potassium channel tetramerization domain containing 9 antikoerper, potassium channel tetramerization domain containing 9b antikoerper, potassium channel tetramerization domain containing 9a antikoerper, potassium channel tetramerization domain containing 9 S homeolog antikoerper, potassium channel tetramerisation domain containing 9 antikoerper, KCTD9 antikoerper, kctd9b antikoerper, kctd9a antikoerper, kctd9.S antikoerper, kctd9 antikoerper, Kctd9 antikoerper

Hintergrund: The function of KCTD9 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)