KCTD9 Antikörper (Middle Region)
-
- Target Alle KCTD9 Produkte
- KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCTD9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCTD9 antibody was raised against the middle region of KCTD9
- Aufreinigung
- Affinity purified
- Immunogen
- KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCTD9 Blocking Peptide, catalog no. 33R-1239, is also available for use as a blocking control in assays to test for specificity of this KCTD9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))
- Andere Bezeichnung
- KCTD9 (KCTD9 Produkte)
- Synonyme
- zgc:101020 antikoerper, KCTD9 antikoerper, MGC159927 antikoerper, kctd9 antikoerper, AA675328 antikoerper, AI854539 antikoerper, BTBD27 antikoerper, potassium channel tetramerization domain containing 9 antikoerper, potassium channel tetramerization domain containing 9b antikoerper, potassium channel tetramerization domain containing 9a antikoerper, potassium channel tetramerization domain containing 9 S homeolog antikoerper, potassium channel tetramerisation domain containing 9 antikoerper, KCTD9 antikoerper, kctd9b antikoerper, kctd9a antikoerper, kctd9.S antikoerper, kctd9 antikoerper, Kctd9 antikoerper
- Hintergrund
- The function of KCTD9 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 42 kDa (MW of target protein)
-