C3orf24 Antikörper (Middle Region)

Produktnummer ABIN632460

Produktdetails anti-C3orf24 Antikörper

Target: C3orf24 (Chromosome 3 Open Reading Frame 24 (C3orf24))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C3orf24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C3 ORF24 antibody was raised against the middle region of C3 rf24

Aufreinigung: Affinity purified

Immunogen: C3 ORF24 antibody was raised using the middle region of C3 rf24 corresponding to a region with amino acids KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3ORF24 Blocking Peptide, catalog no. 33R-4525, is also available for use as a blocking control in assays to test for specificity of this C3ORF24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C3orf24

Target: C3orf24 (Chromosome 3 Open Reading Frame 24 (C3orf24))

Andere Bezeichnung: C3ORF24 (C3orf24 Produkte)

Synonyme: C3orf24 antikoerper, RGD1565997 antikoerper, FANCD2 opposite strand L homeolog antikoerper, FANCD2 opposite strand antikoerper, fancd2os.L antikoerper, FANCD2OS antikoerper, fancd2os antikoerper, Fancd2os antikoerper

Hintergrund: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 20 kDa (MW of target protein)