RPRD1B Antikörper (Middle Region)
-
- Target Alle RPRD1B Antikörper anzeigen
- RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPRD1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPRD1 B antibody was raised against the middle region of RPRD1
- Aufreinigung
- Affinity purified
- Immunogen
- RPRD1 B antibody was raised using the middle region of RPRD1 corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS
- Top Product
- Discover our top product RPRD1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPRD1B Blocking Peptide, catalog no. 33R-4494, is also available for use as a blocking control in assays to test for specificity of this RPRD1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPRD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))
- Andere Bezeichnung
- RPRD1B (RPRD1B Produkte)
- Synonyme
- fb23h08 antikoerper, zgc:55687 antikoerper, wu:fb23h08 antikoerper, rprd1ba antikoerper, MGC130705 antikoerper, C13H20ORF77 antikoerper, C20orf77 antikoerper, CREPT antikoerper, NET60 antikoerper, dJ1057B20.2 antikoerper, 2610304G08Rik antikoerper, 2810446G03Rik antikoerper, Crept antikoerper, RGD1304782 antikoerper, regulation of nuclear pre-mRNA domain containing 1B antikoerper, regulation of nuclear pre-mRNA domain containing 1B L homeolog antikoerper, rprd1b antikoerper, rprd1b.L antikoerper, RPRD1B antikoerper, Rprd1b antikoerper
- Hintergrund
- The function of RPRD1B protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 37 kDa (MW of target protein)
-