SYDE1 Antikörper
-
- Target Alle SYDE1 Antikörper anzeigen
- SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SYDE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
- Top Product
- Discover our top product SYDE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SYDE1 Blocking Peptide, catalog no. 33R-7360, is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYDE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))
- Andere Bezeichnung
- SYDE1 (SYDE1 Produkte)
- Synonyme
- 7h3 antikoerper, 1200008N06Rik antikoerper, BB043000 antikoerper, RGD1305857 antikoerper, synapse defective Rho GTPase homolog 1 antikoerper, synapse defective 1, Rho GTPase, homolog 1 (C. elegans) antikoerper, SYDE1 antikoerper, Syde1 antikoerper
- Hintergrund
- SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
- Molekulargewicht
- 80 kDa (MW of target protein)
-