PDP2 Antikörper (Middle Region)
-
- Target Alle PDP2 Antikörper anzeigen
- PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDP2 antibody was raised against the middle region of PDP2
- Aufreinigung
- Affinity purified
- Immunogen
- PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED
- Top Product
- Discover our top product PDP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDP2 Blocking Peptide, catalog no. 33R-1790, is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))
- Andere Bezeichnung
- PDP2 (PDP2 Produkte)
- Synonyme
- PDP2 antikoerper, DKFZp459I1928 antikoerper, 4833426J09Rik antikoerper, Gm1705 antikoerper, mKIAA1348 antikoerper, PPM2C2 antikoerper, pyruvate dehyrogenase phosphatase catalytic subunit 2 antikoerper, PDP2 antikoerper, pdp2 antikoerper, Pdp2 antikoerper
- Hintergrund
- PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
- Molekulargewicht
- 60 kDa (MW of target protein)
-