VTA1 Antikörper

Produktnummer ABIN632410

Produktdetails anti-VTA1 Antikörper

Target: VTA1 (Vps20-Associated 1 Homolog (VTA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VTA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VTA1 Blocking Peptide, catalog no. 33R-4488, is also available for use as a blocking control in assays to test for specificity of this VTA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VTA1

Target: VTA1 (Vps20-Associated 1 Homolog (VTA1))

Andere Bezeichnung: VTA1 (VTA1 Produkte)

Synonyme: C6orf55 antikoerper, DRG-1 antikoerper, DRG1 antikoerper, LIP5 antikoerper, My012 antikoerper, SBP1 antikoerper, 1110001D18Rik antikoerper, 1110059P08Rik antikoerper, AU040813 antikoerper, C85340 antikoerper, Lip5 antikoerper, RGD1305031 antikoerper, Vps20-associated 1 homolog antikoerper, vesicle trafficking 1 antikoerper, vesicle (multivesicular body) trafficking 1 antikoerper, Vta1 antikoerper, VTA1 antikoerper

Hintergrund: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.

Molekulargewicht: 34 kDa (MW of target protein)