RIMKLA Antikörper (Middle Region)
-
- Target Alle RIMKLA Antikörper anzeigen
- RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RIMKLA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM80 A antibody was raised against the middle region of FAM80
- Aufreinigung
- Affinity purified
- Immunogen
- FAM80 A antibody was raised using the middle region of FAM80 corresponding to a region with amino acids EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV
- Top Product
- Discover our top product RIMKLA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM80A Blocking Peptide, catalog no. 33R-2255, is also available for use as a blocking control in assays to test for specificity of this FAM80A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))
- Andere Bezeichnung
- FAM80A (RIMKLA Produkte)
- Synonyme
- FAM80A antikoerper, NAAGS antikoerper, NAAGS-II antikoerper, B930030J24 antikoerper, Rimk antikoerper, RGD1306880 antikoerper, ribosomal modification protein rimK like family member A antikoerper, ribosomal modification protein rimK-like family member A antikoerper, RIMKLA antikoerper, Rimkla antikoerper
- Hintergrund
- The specific function of FAM80A is not yet known.
- Molekulargewicht
- 38 kDa (MW of target protein)
-