RIMKLA Antikörper (Middle Region)

Produktnummer ABIN632370

Der Kaninchen Polyklonal anti-RIMKLA Antikörper (ABIN632370) detektiert spezifisch RIMKLA in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für RIMKLA Antikörper (Middle Region) (ABIN632370)

Target: RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RIMKLA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RIMKLA Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM80 A antibody was raised against the middle region of FAM80

Aufreinigung: Affinity purified

Immunogen: FAM80 A antibody was raised using the middle region of FAM80 corresponding to a region with amino acids EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM80A Blocking Peptide, (ABIN937641), is also available for use as a blocking control in assays to test for specificity of this FAM80A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RIMKLA

Target: RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))

Andere Bezeichnung: FAM80A

Hintergrund: The specific function of FAM80A is not yet known.

Molekulargewicht: 38 kDa (MW of target protein)