CDRT4 Antikörper (Middle Region)
-
- Target Alle CDRT4 Produkte
- CDRT4 (CMT1A Duplicated Region Transcript 4 (CDRT4))
-
Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDRT4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDRT4 antibody was raised against the middle region of CDRT4
- Aufreinigung
- Affinity purified
- Immunogen
- CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDRT4 Blocking Peptide, catalog no. 33R-9293, is also available for use as a blocking control in assays to test for specificity of this CDRT4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDRT4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDRT4 (CMT1A Duplicated Region Transcript 4 (CDRT4))
- Andere Bezeichnung
- CDRT4 (CDRT4 Produkte)
- Synonyme
- 1700019I23Rik antikoerper, CMT1A duplicated region transcript 4 antikoerper, CDRT4 antikoerper, Cdrt4 antikoerper
- Hintergrund
- The specific function of CDRT4 is not yet known.
- Molekulargewicht
- 17 kDa (MW of target protein)
-