FBXL16 Antikörper (Middle Region)
-
- Target Alle FBXL16 Antikörper anzeigen
- FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXL16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXL16 antibody was raised against the middle region of FBXL16
- Aufreinigung
- Affinity purified
- Immunogen
- FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
- Top Product
- Discover our top product FBXL16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXL16 Blocking Peptide, catalog no. 33R-3191, is also available for use as a blocking control in assays to test for specificity of this FBXL16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))
- Andere Bezeichnung
- FBXL16 (FBXL16 Produkte)
- Synonyme
- C16orf22 antikoerper, Fbl16 antikoerper, c380A1.1 antikoerper, BC042620 antikoerper, Scirr1 antikoerper, VIER F-box proteine 2 antikoerper, F-box and leucine rich repeat protein 16 antikoerper, fbxl16, putative antikoerper, F-box and leucine-rich repeat protein 16 antikoerper, VIER F-box protein 2 antikoerper, FBXL16 antikoerper, Smp_174380 antikoerper, fbxl16 antikoerper, Fbxl16 antikoerper, VFB2 antikoerper
- Hintergrund
- FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.
- Molekulargewicht
- 52 kDa (MW of target protein)
-