FBXL16 Antikörper (Middle Region)

Produktnummer ABIN632354

Produktdetails anti-FBXL16 Antikörper

Target: FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXL16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXL16 antibody was raised against the middle region of FBXL16

Aufreinigung: Affinity purified

Immunogen: FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXL16 Blocking Peptide, catalog no. 33R-3191, is also available for use as a blocking control in assays to test for specificity of this FBXL16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXL16

Target: FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))

Andere Bezeichnung: FBXL16 (FBXL16 Produkte)

Synonyme: C16orf22 antikoerper, Fbl16 antikoerper, c380A1.1 antikoerper, BC042620 antikoerper, Scirr1 antikoerper, VIER F-box proteine 2 antikoerper, F-box and leucine rich repeat protein 16 antikoerper, fbxl16, putative antikoerper, F-box and leucine-rich repeat protein 16 antikoerper, VIER F-box protein 2 antikoerper, FBXL16 antikoerper, Smp_174380 antikoerper, fbxl16 antikoerper, Fbxl16 antikoerper, VFB2 antikoerper

Hintergrund: FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Molekulargewicht: 52 kDa (MW of target protein)