Plastin 3 Antikörper
-
- Target Alle Plastin 3 (PLS3) Antikörper anzeigen
- Plastin 3 (PLS3)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Plastin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Plastin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS
- Top Product
- Discover our top product PLS3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Plastin 3 Blocking Peptide, catalog no. 33R-8170, is also available for use as a blocking control in assays to test for specificity of this Plastin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Plastin 3 (PLS3)
- Andere Bezeichnung
- Plastin 3 (PLS3 Produkte)
- Synonyme
- T-plastin antikoerper, AI115446 antikoerper, AL024105 antikoerper, T-fimbrin antikoerper, MGC68681 antikoerper, t-plastin antikoerper, MGC106020 antikoerper, DKFZp459D0939 antikoerper, PLS3 antikoerper, Plastin-3 antikoerper, wu:fc04g03 antikoerper, zgc:91903 antikoerper, plastin 3 antikoerper, plastin 3 (T-isoform) antikoerper, plastin 3 L homeolog antikoerper, plastin 3 (T isoform) antikoerper, PLS3 antikoerper, Pls3 antikoerper, pls3.L antikoerper, pls3 antikoerper
- Hintergrund
- Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.
- Molekulargewicht
- 71 kDa (MW of target protein)
-