Plastin 3 Antikörper

Produktnummer ABIN632329

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Plastin 3 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für Plastin 3 Antikörper (ABIN632329)

Target: Plastin 3 (PLS3)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Plastin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Plastin 3 Antikörper

Aufreinigung: Affinity purified

Immunogen: Plastin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Plastin 3 Blocking Peptide, (ABIN5615406), is also available for use as a blocking control in assays to test for specificity of this Plastin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Plastin 3

Target: Plastin 3 (PLS3)

Andere Bezeichnung: Plastin 3

Hintergrund: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

Molekulargewicht: 71 kDa (MW of target protein)