MRPL13 Antikörper (Middle Region)
-
- Target Alle MRPL13 Antikörper anzeigen
- MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MRPL13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MRPL13 antibody was raised against the middle region of MRPL13
- Aufreinigung
- Affinity purified
- Immunogen
- MRPL13 antibody was raised using the middle region of MRPL13 corresponding to a region with amino acids AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD
- Top Product
- Discover our top product MRPL13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MRPL13 Blocking Peptide, catalog no. 33R-1286, is also available for use as a blocking control in assays to test for specificity of this MRPL13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))
- Andere Bezeichnung
- MRPL13 (MRPL13 Produkte)
- Synonyme
- CG10602 antikoerper, CG10603 antikoerper, Dmel\\CG10603 antikoerper, L13 antikoerper, anon-EST:fe3C4 antikoerper, GB12738 antikoerper, MGC135435 antikoerper, zgc:109948 antikoerper, MRPL13 antikoerper, YK105 antikoerper, L13A antikoerper, L13mt antikoerper, RPL13 antikoerper, RPML13 antikoerper, 1110002D09Rik antikoerper, mitochondrial ribosomal protein L13 antikoerper, 39S ribosomal protein L13, mitochondrial antikoerper, mitochondrial ribosomal protein L13 S homeolog antikoerper, mitochondrial 54S ribosomal protein YmL13 antikoerper, Putative mitochondrial ribosomal protein L13 antikoerper, mRpL13 antikoerper, LOC413928 antikoerper, MRPL13 antikoerper, mrpl13.S antikoerper, mrpl13 antikoerper, LOC770396 antikoerper, mrpL13 antikoerper, Mrpl13 antikoerper
- Hintergrund
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.
- Molekulargewicht
- 21 kDa (MW of target protein)
-