ASB7 Antikörper (Middle Region)

Produktnummer ABIN632314

Produktdetails anti-ASB7 Antikörper

Target: ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASB7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ASB7 antibody was raised against the middle region of ASB7

Aufreinigung: Affinity purified

Immunogen: ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASB7 Blocking Peptide, catalog no. 33R-7760, is also available for use as a blocking control in assays to test for specificity of this ASB7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASB7

Target: ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))

Andere Bezeichnung: ASB7 (ASB7 Produkte)

Synonyme: AI449039 antikoerper, Asb-7 antikoerper, D030055C23Rik antikoerper, asb7 antikoerper, zgc:77381 antikoerper, ASB-7 antikoerper, ankyrin repeat and SOCS box containing 7 antikoerper, ankyrin repeat and SOCS box-containing 7 antikoerper, ankyrin repeat and SOCS box containing 7 L homeolog antikoerper, ASB7 antikoerper, Asb7 antikoerper, asb7.L antikoerper, asb7 antikoerper

Hintergrund: The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.

Molekulargewicht: 36 kDa (MW of target protein)