NOB1 Antikörper
-
- Target Alle NOB1 Antikörper anzeigen
- NOB1 (RNA-Binding Protein NOB1 (NOB1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI
- Top Product
- Discover our top product NOB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOB1 Blocking Peptide, catalog no. 33R-9043, is also available for use as a blocking control in assays to test for specificity of this NOB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOB1 (RNA-Binding Protein NOB1 (NOB1))
- Andere Bezeichnung
- NOB1 (NOB1 Produkte)
- Synonyme
- MEE6.26 antikoerper, MEE6_26 antikoerper, Nob1p antikoerper, fc27e05 antikoerper, si:ch73-167i17.3 antikoerper, wu:fc27e05 antikoerper, ART-4 antikoerper, MST158 antikoerper, NOB1P antikoerper, PSMD8BP1 antikoerper, 1700021I09Rik antikoerper, Psmd8bp1 antikoerper, NIN1/PSMD8 binding protein 1 homolog antikoerper, RNA-binding NOB1-like protein antikoerper, RNA-binding protein nob1 antikoerper, RNA-binding protein NOB1 antikoerper, NIN1/RPN12 binding protein 1 homolog S homeolog antikoerper, NIN1/RPN12 binding protein 1 homolog (S. cerevisiae) antikoerper, NIN1/RPN12 binding protein 1 homolog antikoerper, NOB1 antikoerper, AT5G41190 antikoerper, EDI_130960 antikoerper, CpipJ_CPIJ012739 antikoerper, BDBG_01281 antikoerper, PAAG_04204 antikoerper, PITG_13300 antikoerper, nob1.S antikoerper, nob1 antikoerper, Nob1 antikoerper
- Hintergrund
- NOB1 may play a role in mRNA degradation.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-