Tektin 4 Antikörper (N-Term)
-
- Target Alle Tektin 4 (TEKT4) Antikörper anzeigen
- Tektin 4 (TEKT4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tektin 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Tektin 4 antibody was raised against the N terminal of TEKT4
- Aufreinigung
- Affinity purified
- Immunogen
- Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ
- Top Product
- Discover our top product TEKT4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tektin 4 Blocking Peptide, catalog no. 33R-9288, is also available for use as a blocking control in assays to test for specificity of this Tektin 4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEKT4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tektin 4 (TEKT4)
- Andere Bezeichnung
- Tektin 4 (TEKT4 Produkte)
- Synonyme
- ECGP antikoerper, GP96 antikoerper, GRP94 antikoerper, TRA1 antikoerper, 1700010L19Rik antikoerper, RGD1308075 antikoerper, Tek4 antikoerper, Tektin4 antikoerper, Tekt4 antikoerper, heat shock protein 90 beta family member 1 antikoerper, tektin 4 antikoerper, tektin-4 antikoerper, tektin 4 S homeolog antikoerper, HSP90B1 antikoerper, Tekt4 antikoerper, TEKT4 antikoerper, LOC490081 antikoerper, tekt4.S antikoerper, tekt4 antikoerper, LOC100719827 antikoerper, LOC110259951 antikoerper
- Hintergrund
- TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.
- Molekulargewicht
- 51 kDa (MW of target protein)
-