PRMT6 Antikörper (Middle Region)
-
- Target Alle PRMT6 Antikörper anzeigen
- PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRMT6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRMT6 antibody was raised against the middle region of PRMT6
- Aufreinigung
- Affinity purified
- Immunogen
- PRMT6 antibody was raised using the middle region of PRMT6 corresponding to a region with amino acids FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY
- Top Product
- Discover our top product PRMT6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRMT6 Blocking Peptide, catalog no. 33R-3040, is also available for use as a blocking control in assays to test for specificity of this PRMT6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))
- Andere Bezeichnung
- PRMT6 (PRMT6 Produkte)
- Synonyme
- CG9927 antikoerper, DART6 antikoerper, Dmel\\CG9927 antikoerper, PRMT6 antikoerper, HRMT1L6 antikoerper, ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 6 antikoerper, ATPRMT6 antikoerper, protein arginine methyltransferase 6 antikoerper, DKFZp459B1431 antikoerper, Hrmt1l6 antikoerper, hrmt1l6 antikoerper, hrmt6 antikoerper, im:6908706 antikoerper, AW124876 antikoerper, BB233495 antikoerper, Arginine methyltransferase 6 antikoerper, protein arginine methyltransferase 6 antikoerper, protein arginine methyltransferase 6 S homeolog antikoerper, arginine N-methyltransferase, type I antikoerper, protein arginine N-methyltransferase 6 antikoerper, Art6 antikoerper, PRMT6 antikoerper, prmt6.S antikoerper, prmt6 antikoerper, Prmt6 antikoerper
- Hintergrund
- Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.
- Molekulargewicht
- 35 kDa (MW of target protein)
-