PRMT6 Antikörper (Middle Region)

Produktnummer ABIN632280

Produktdetails anti-PRMT6 Antikörper

Target: PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRMT6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRMT6 antibody was raised against the middle region of PRMT6

Aufreinigung: Affinity purified

Immunogen: PRMT6 antibody was raised using the middle region of PRMT6 corresponding to a region with amino acids FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRMT6 Blocking Peptide, catalog no. 33R-3040, is also available for use as a blocking control in assays to test for specificity of this PRMT6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRMT6

Target: PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))

Andere Bezeichnung: PRMT6 (PRMT6 Produkte)

Synonyme: CG9927 antikoerper, DART6 antikoerper, Dmel\\CG9927 antikoerper, PRMT6 antikoerper, HRMT1L6 antikoerper, ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 6 antikoerper, ATPRMT6 antikoerper, protein arginine methyltransferase 6 antikoerper, DKFZp459B1431 antikoerper, Hrmt1l6 antikoerper, hrmt1l6 antikoerper, hrmt6 antikoerper, im:6908706 antikoerper, AW124876 antikoerper, BB233495 antikoerper, Arginine methyltransferase 6 antikoerper, protein arginine methyltransferase 6 antikoerper, protein arginine methyltransferase 6 S homeolog antikoerper, arginine N-methyltransferase, type I antikoerper, protein arginine N-methyltransferase 6 antikoerper, Art6 antikoerper, PRMT6 antikoerper, prmt6.S antikoerper, prmt6 antikoerper, Prmt6 antikoerper

Hintergrund: Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.

Molekulargewicht: 35 kDa (MW of target protein)