VPS54 Antikörper
-
- Target Alle VPS54 Antikörper anzeigen
- VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPS54 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR
- Top Product
- Discover our top product VPS54 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPS54 Blocking Peptide, catalog no. 33R-3139, is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS54 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))
- Andere Bezeichnung
- VPS54 (VPS54 Produkte)
- Synonyme
- 5330404P15Rik antikoerper, Hcc8 antikoerper, Vps54l antikoerper, mSLP8 antikoerper, wr antikoerper, HCC8 antikoerper, SLP-8p antikoerper, VPS54L antikoerper, WR antikoerper, hVps54L antikoerper, Vsp54 antikoerper, Vacuolar protein sorting-associated protein 54 antikoerper, VPS54 GARP complex subunit antikoerper, VPS54, GARP complex subunit antikoerper, vps-54 antikoerper, Vps54 antikoerper, VPS54 antikoerper
- Hintergrund
- VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi.
- Molekulargewicht
- 107 kDa (MW of target protein)
-