TPRN Antikörper (Middle Region)
-
- Target Alle TPRN Antikörper anzeigen
- TPRN (Taperin (TPRN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TPRN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C9 ORF75 antibody was raised against the middle region of C9 rf75
- Aufreinigung
- Affinity purified
- Immunogen
- C9 ORF75 antibody was raised using the middle region of C9 rf75 corresponding to a region with amino acids PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA
- Top Product
- Discover our top product TPRN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C9ORF75 Blocking Peptide, catalog no. 33R-7251, is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPRN (Taperin (TPRN))
- Andere Bezeichnung
- C9ORF75 (TPRN Produkte)
- Synonyme
- C9orf75 antikoerper, DFNB79 antikoerper, RP11-350O14.7 antikoerper, C430004E15Rik antikoerper, C87750 antikoerper, RP23-132N23.15 antikoerper, taperin antikoerper, TPRN antikoerper, Tprn antikoerper
- Hintergrund
- The specific function of C9orf75 is not yet known.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-