NCDN Antikörper (N-Term)

Produktnummer ABIN632258

Produktdetails anti-NCDN Antikörper

Target: NCDN (Neurochondrin (NCDN))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NCDN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Neurochondrin antibody was raised against the N terminal of NCDN

Aufreinigung: Affinity purified

Immunogen: Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Neurochondrin Blocking Peptide, catalog no. 33R-6403, is also available for use as a blocking control in assays to test for specificity of this Neurochondrin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCDN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NCDN

Target: NCDN (Neurochondrin (NCDN))

Andere Bezeichnung: Neurochondrin (NCDN Produkte)

Synonyme: CG2330 antikoerper, Dmel\\CG2330 antikoerper, NCDN antikoerper, GB14786 antikoerper, AU042419 antikoerper, MMS10-AE antikoerper, Ms10ae antikoerper, mKIAA0607 antikoerper, norbin antikoerper, Norbin antikoerper, CG2330 gene product from transcript CG2330-RA antikoerper, neurochondrin antikoerper, N-acylneuraminate-9-phosphatase antikoerper, neurochondrin S homeolog antikoerper, Neurochondrin antikoerper, NCDN antikoerper, LOC552430 antikoerper, ncdn antikoerper, Ncdn antikoerper, ncdn.S antikoerper

Hintergrund: This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes.

Molekulargewicht: 79 kDa (MW of target protein)