ITPK1 Antikörper (Middle Region)

Produktnummer ABIN632257

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ITPK1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ITPK1 Antikörper (Middle Region) (ABIN632257)

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITPK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ITPK1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ITPK1 antibody was raised against the middle region of ITPK1

Aufreinigung: Affinity purified

Immunogen: ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITPK1 Blocking Peptide, (ABIN5614232), is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITPK1

Target: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Andere Bezeichnung: ITPK1

Hintergrund: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.

Molekulargewicht: 45 kDa (MW of target protein)