ITPK1 Antikörper (Middle Region)
-
- Target Alle ITPK1 Antikörper anzeigen
- ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ITPK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ITPK1 antibody was raised against the middle region of ITPK1
- Aufreinigung
- Affinity purified
- Immunogen
- ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI
- Top Product
- Discover our top product ITPK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ITPK1 Blocking Peptide, catalog no. 33R-6637, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))
- Andere Bezeichnung
- ITPK1 (ITPK1 Produkte)
- Synonyme
- ITRPK1 antikoerper, BC031182 antikoerper, wu:fj15d08 antikoerper, zgc:56075 antikoerper, inositol-tetrakisphosphate 1-kinase antikoerper, inositol 1,3,4-triphosphate 5/6 kinase antikoerper, inositol-tetrakisphosphate 1-kinase L homeolog antikoerper, inositol-tetrakisphosphate 1-kinase a antikoerper, ITPK1 antikoerper, Itpk1 antikoerper, itpk1.L antikoerper, itpk1a antikoerper
- Hintergrund
- ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3.
- Molekulargewicht
- 45 kDa (MW of target protein)
-