OCIAD2 Antikörper (Middle Region)

Produktnummer ABIN632251

Produktdetails anti-OCIAD2 Antikörper

Target: OCIAD2 (OCIA Domain Containing 2 (OCIAD2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OCIAD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OCIAD2 antibody was raised against the middle region of OCIAD2

Aufreinigung: Affinity purified

Immunogen: OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OCIAD2 Blocking Peptide, catalog no. 33R-7576, is also available for use as a blocking control in assays to test for specificity of this OCIAD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCIAD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OCIAD2

Target: OCIAD2 (OCIA Domain Containing 2 (OCIAD2))

Andere Bezeichnung: OCIAD2 (OCIAD2 Produkte)

Synonyme: 1810027I20Rik antikoerper, OCIA domain containing 2 L homeolog antikoerper, OCIA domain containing 2 antikoerper, ociad2.L antikoerper, OCIAD2 antikoerper, Ociad2 antikoerper

Hintergrund: The exact function of OCIAD2 is not known.

Molekulargewicht: 17 kDa (MW of target protein)