PAICS Antikörper (N-Term)

Produktnummer ABIN632240

Der Kaninchen Polyklonal anti-PAICS Antikörper wird verwendet zum Nachweis von PAICS in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für PAICS Antikörper (N-Term) (ABIN632240)

Target: PAICS (phosphoribosylaminoimidazole Carboxylase, phosphoribosylaminoimidazole Succinocarboxamide Synthetase (PAICS))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAICS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAICS Antikörper

Bindungsspezifität: N-Term

Spezifität: PAICS antibody was raised against the N terminal of PAICS

Aufreinigung: Affinity purified

Immunogen: PAICS antibody was raised using the N terminal of PAICS corresponding to a region with amino acids ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAICS Blocking Peptide, (ABIN936933), is also available for use as a blocking control in assays to test for specificity of this PAICS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAICS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAICS

Target: PAICS (phosphoribosylaminoimidazole Carboxylase, phosphoribosylaminoimidazole Succinocarboxamide Synthetase (PAICS))

Andere Bezeichnung: PAICS

Hintergrund: PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Chromatin Binding