PAICS Antikörper (N-Term)
-
- Target Alle PAICS Antikörper anzeigen
- PAICS (phosphoribosylaminoimidazole Carboxylase, phosphoribosylaminoimidazole Succinocarboxamide Synthetase (PAICS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAICS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PAICS antibody was raised against the N terminal of PAICS
- Aufreinigung
- Affinity purified
- Immunogen
- PAICS antibody was raised using the N terminal of PAICS corresponding to a region with amino acids ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE
- Top Product
- Discover our top product PAICS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAICS Blocking Peptide, catalog no. 33R-1547, is also available for use as a blocking control in assays to test for specificity of this PAICS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAICS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAICS (phosphoribosylaminoimidazole Carboxylase, phosphoribosylaminoimidazole Succinocarboxamide Synthetase (PAICS))
- Andere Bezeichnung
- PAICS (PAICS Produkte)
- Synonyme
- cb293 antikoerper, sb:cb293 antikoerper, wu:fa28a05 antikoerper, GB14262 antikoerper, DDBDRAFT_0218550 antikoerper, DDBDRAFT_0230088 antikoerper, DDB_0218550 antikoerper, DDB_0230088 antikoerper, AIRC antikoerper, AS antikoerper, ADE2 antikoerper, ADE2H1 antikoerper, PAIS antikoerper, Ade2h1 antikoerper, Airc antikoerper, ade2 antikoerper, airc antikoerper, paics antikoerper, pais antikoerper, 2610511I09Rik antikoerper, phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase antikoerper, phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase antikoerper, multifunctional protein ADE2 antikoerper, phosphoribosylaminoimidazole carboxylase antikoerper, phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase, gene 2 L homeolog antikoerper, phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase antikoerper, PAICS antikoerper, paics antikoerper, LOC551966 antikoerper, Tsp_02239a antikoerper, Tsp_02239 antikoerper, CNE02500 antikoerper, purC/E antikoerper, Paics antikoerper, paics.2.L antikoerper
- Hintergrund
- PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-