FAM45B Antikörper (Middle Region)

Produktnummer ABIN632226

Produktdetails anti-FAM45B Antikörper

Target: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM45B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM45 B antibody was raised against the middle region of FAM45

Aufreinigung: Affinity purified

Immunogen: FAM45 B antibody was raised using the middle region of FAM45 corresponding to a region with amino acids AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM45B Blocking Peptide, catalog no. 33R-1121, is also available for use as a blocking control in assays to test for specificity of this FAM45B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM45B

Target: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Andere Bezeichnung: FAM45B (FAM45B Produkte)

Synonyme: HT011 antikoerper, family with sequence similarity 45, member A pseudogene antikoerper, FAM45BP antikoerper

Hintergrund: The function of FAM45 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 40 kDa (MW of target protein)