GNaZ Antikörper
-
- Target Alle GNaZ Antikörper anzeigen
- GNaZ (Guanine Nucleotide Binding Protein (G Protein), alpha Z Polypeptide (GNaZ))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNaZ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNAZ antibody was raised using a synthetic peptide corresponding to a region with amino acids LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT
- Top Product
- Discover our top product GNaZ Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNAZ Blocking Peptide, catalog no. 33R-5047, is also available for use as a blocking control in assays to test for specificity of this GNAZ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAZ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNaZ (Guanine Nucleotide Binding Protein (G Protein), alpha Z Polypeptide (GNaZ))
- Andere Bezeichnung
- GNAZ (GNaZ Produkte)
- Synonyme
- GXA antikoerper, AI847979 antikoerper, Gz antikoerper, G protein subunit alpha z antikoerper, guanine nucleotide binding protein, alpha z subunit antikoerper, GNAZ antikoerper, Gnaz antikoerper
- Hintergrund
- GNAZ is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- G-protein mediated Events
-