EBI3 Antikörper (Middle Region)

Produktnummer ABIN632221

Produktdetails anti-EBI3 Antikörper

Target: EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EBI3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EBI3 antibody was raised against the middle region of EBI3

Aufreinigung: Affinity purified

Immunogen: EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EBI3 Blocking Peptide, catalog no. 33R-8990, is also available for use as a blocking control in assays to test for specificity of this EBI3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBI3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EBI3

Target: EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))

Andere Bezeichnung: EBI3 (IL-27b Produkte)

Synonyme: IL-27B antikoerper, IL27B antikoerper, EBI3 antikoerper, il-27rb antikoerper, si:dkey-97a13.4 antikoerper, EBI-3 antikoerper, IL-27 antikoerper, Epstein-Barr virus induced 3 antikoerper, Epstein-Barr virus induced gene 3 antikoerper, EBI3 antikoerper, ebi3 antikoerper, Ebi3 antikoerper

Substanzklasse: Viral Protein

Hintergrund: This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.

Molekulargewicht: 23 kDa (MW of target protein)