ZSWIM3 Antikörper (N-Term)
-
- Target Alle ZSWIM3 Produkte
- ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZSWIM3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZSWIM3 antibody was raised against the N terminal of ZSWIM3
- Aufreinigung
- Affinity purified
- Immunogen
- ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZSWIM3 Blocking Peptide, catalog no. 33R-8928, is also available for use as a blocking control in assays to test for specificity of this ZSWIM3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZSWIM3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))
- Andere Bezeichnung
- ZSWIM3 (ZSWIM3 Produkte)
- Synonyme
- 4921517A06Rik antikoerper, C86566 antikoerper, C20orf164 antikoerper, zinc finger SWIM-type containing 3 antikoerper, zinc finger, SWIM-type containing 3 antikoerper, ZSWIM3 antikoerper, Zswim3 antikoerper
- Hintergrund
- The function of ZSWIM3 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 77 kDa (MW of target protein)
-