ZSWIM3 Antikörper (N-Term)

Produktnummer ABIN632219

Produktdetails anti-ZSWIM3 Antikörper

Target: ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZSWIM3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZSWIM3 antibody was raised against the N terminal of ZSWIM3

Aufreinigung: Affinity purified

Immunogen: ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZSWIM3 Blocking Peptide, catalog no. 33R-8928, is also available for use as a blocking control in assays to test for specificity of this ZSWIM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZSWIM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZSWIM3

Target: ZSWIM3 (Zinc Finger, SWIM-Type Containing 3 (ZSWIM3))

Andere Bezeichnung: ZSWIM3 (ZSWIM3 Produkte)

Synonyme: 4921517A06Rik antikoerper, C86566 antikoerper, C20orf164 antikoerper, zinc finger SWIM-type containing 3 antikoerper, zinc finger, SWIM-type containing 3 antikoerper, ZSWIM3 antikoerper, Zswim3 antikoerper

Hintergrund: The function of ZSWIM3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 77 kDa (MW of target protein)