TNFAIP8L1 Antikörper (Middle Region)

Produktnummer ABIN632217

Produktdetails anti-TNFAIP8L1 Antikörper

Target: TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNFAIP8L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TNFAIP8 L1 antibody was raised against the middle region of TNFAIP8 1

Aufreinigung: Affinity purified

Immunogen: TNFAIP8 L1 antibody was raised using the middle region of TNFAIP8 1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNFAIP8L1 Blocking Peptide, catalog no. 33R-1311, is also available for use as a blocking control in assays to test for specificity of this TNFAIP8L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFAIP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNFAIP8L1

Target: TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))

Andere Bezeichnung: TNFAIP8L1 (TNFAIP8L1 Produkte)

Synonyme: TIPE1 antikoerper, 2600017J23Rik antikoerper, TNF alpha induced protein 8 like 1 antikoerper, tumor necrosis factor, alpha-induced protein 8-like 1 antikoerper, TNFAIP8L1 antikoerper, Tnfaip8l1 antikoerper

Hintergrund: TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.

Molekulargewicht: 21 kDa (MW of target protein)