VIPAR Antikörper (Middle Region)

Produktnummer ABIN632204

Der Kaninchen Polyklonal anti-VIPAR Antikörper wird verwendet zum Nachweis von VIPAR in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für VIPAR Antikörper (Middle Region) (ABIN632204)

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VIPAR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VIPAR Antikörper

Bindungsspezifität: Middle Region

Spezifität: VIPAR antibody was raised against the middle region of VIPAR

Aufreinigung: Affinity purified

Immunogen: VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VIPAR Blocking Peptide, (ABIN5616968), is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VIPAR

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Andere Bezeichnung: VIPAR

Hintergrund: This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.

Molekulargewicht: 57 kDa (MW of target protein)