VIPAR Antikörper (Middle Region)

Produktnummer ABIN632204

Produktdetails anti-VIPAR Antikörper

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VIPAR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VIPAR antibody was raised against the middle region of VIPAR

Aufreinigung: Affinity purified

Immunogen: VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VIPAR Blocking Peptide, catalog no. 33R-9490, is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VIPAR

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Andere Bezeichnung: VIPAR (VIPAR Produkte)

Synonyme: C8H14orf133 antikoerper, VIPAR antikoerper, VPS16 antikoerper, VPS16A antikoerper, spe39 antikoerper, spe-39 antikoerper, vps16b antikoerper, MGC85203 antikoerper, c14orf133 antikoerper, C14orf133 antikoerper, SPE-39 antikoerper, SPE39 antikoerper, VPS16B antikoerper, hSPE-39 antikoerper, 6720456H09Rik antikoerper, 9330175H22Rik antikoerper, AI413782 antikoerper, Spe39 antikoerper, Vipar antikoerper, si:ch211-20b12.1 antikoerper, vipar antikoerper, wu:fb63f10 antikoerper, C10H14orf133 antikoerper, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog antikoerper, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog L homeolog antikoerper, VIPAS39 antikoerper, vipas39.L antikoerper, vipas39 antikoerper, Vipas39 antikoerper

Hintergrund: This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.

Molekulargewicht: 57 kDa (MW of target protein)