VIPAR Antikörper (Middle Region)
-
- Target Alle VIPAR Antikörper anzeigen
- VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VIPAR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VIPAR antibody was raised against the middle region of VIPAR
- Aufreinigung
- Affinity purified
- Immunogen
- VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI
- Top Product
- Discover our top product VIPAR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VIPAR Blocking Peptide, catalog no. 33R-9490, is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))
- Andere Bezeichnung
- VIPAR (VIPAR Produkte)
- Synonyme
- C8H14orf133 antikoerper, VIPAR antikoerper, VPS16 antikoerper, VPS16A antikoerper, spe39 antikoerper, spe-39 antikoerper, vps16b antikoerper, MGC85203 antikoerper, c14orf133 antikoerper, C14orf133 antikoerper, SPE-39 antikoerper, SPE39 antikoerper, VPS16B antikoerper, hSPE-39 antikoerper, 6720456H09Rik antikoerper, 9330175H22Rik antikoerper, AI413782 antikoerper, Spe39 antikoerper, Vipar antikoerper, si:ch211-20b12.1 antikoerper, vipar antikoerper, wu:fb63f10 antikoerper, C10H14orf133 antikoerper, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog antikoerper, VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog L homeolog antikoerper, VIPAS39 antikoerper, vipas39.L antikoerper, vipas39 antikoerper, Vipas39 antikoerper
- Hintergrund
- This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.
- Molekulargewicht
- 57 kDa (MW of target protein)
-