CCDC25 Antikörper (Middle Region)

Produktnummer ABIN632195

Produktdetails anti-CCDC25 Antikörper

Target: CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC25 antibody was raised against the middle region of CCDC25

Aufreinigung: Affinity purified

Immunogen: CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC25 Blocking Peptide, catalog no. 33R-2035, is also available for use as a blocking control in assays to test for specificity of this CCDC25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC25

Target: CCDC25 (Coiled-Coil Domain Containing 25 (CCDC25))

Andere Bezeichnung: CCDC25 (CCDC25 Produkte)

Synonyme: 2610528H13Rik antikoerper, NSrp70 antikoerper, RGD1307689 antikoerper, coiled-coil domain containing 25 antikoerper, CCDC25 antikoerper, Ccdc25 antikoerper

Hintergrund: The function of CCDC25 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 24 kDa (MW of target protein)