TMOD3 Antikörper

Produktnummer ABIN632188

Produktdetails anti-TMOD3 Antikörper

Target: TMOD3 (Tropomodulin 3 (TMOD3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMOD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tropomodulin 3 Blocking Peptide, catalog no. 33R-4183, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMOD3

Target: TMOD3 (Tropomodulin 3 (TMOD3))

Andere Bezeichnung: Tropomodulin 3 (TMOD3 Produkte)

Synonyme: TMOD3 antikoerper, tropomodulin-3 antikoerper, UTMOD antikoerper, MGC53545 antikoerper, U-Tmod antikoerper, tropomodulin 3 antikoerper, tropomodulin 3 S homeolog antikoerper, TMOD3 antikoerper, Tmod3 antikoerper, tmod3.S antikoerper, tmod3 antikoerper

Hintergrund: TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization