EPB42 Antikörper (Middle Region)
-
- Target Alle EPB42 Antikörper anzeigen
- EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPB42 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EPB42 antibody was raised against the middle region of EPB42
- Aufreinigung
- Affinity purified
- Immunogen
- EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP
- Top Product
- Discover our top product EPB42 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EPB42 Blocking Peptide, catalog no. 33R-4166, is also available for use as a blocking control in assays to test for specificity of this EPB42 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB42 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))
- Andere Bezeichnung
- EPB42 (EPB42 Produkte)
- Synonyme
- PA antikoerper, SPH5 antikoerper, Epb4.2 antikoerper, Epb42 antikoerper, erythrocyte membrane protein band 4.2 antikoerper, EPB42 antikoerper, Epb42 antikoerper
- Hintergrund
- Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.
- Molekulargewicht
- 80 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-