EPB42 Antikörper (Middle Region)

Produktnummer ABIN632184

Produktdetails anti-EPB42 Antikörper

Target: EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPB42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EPB42 antibody was raised against the middle region of EPB42

Aufreinigung: Affinity purified

Immunogen: EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPB42 Blocking Peptide, catalog no. 33R-4166, is also available for use as a blocking control in assays to test for specificity of this EPB42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPB42

Target: EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))

Andere Bezeichnung: EPB42 (EPB42 Produkte)

Synonyme: PA antikoerper, SPH5 antikoerper, Epb4.2 antikoerper, Epb42 antikoerper, erythrocyte membrane protein band 4.2 antikoerper, EPB42 antikoerper, Epb42 antikoerper

Hintergrund: Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis