DNAJB1 Antikörper

Produktnummer ABIN632179

Produktdetails anti-DNAJB1 Antikörper

Target: DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DNAJB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJB1 Blocking Peptide, catalog no. 33R-3564, is also available for use as a blocking control in assays to test for specificity of this DNAJB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJB1

Target: DNAJB1 (DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1))

Andere Bezeichnung: DNAJB1 (DNAJB1 Produkte)

Synonyme: HSPF1 antikoerper, Hdj1 antikoerper, Hsp40 antikoerper, RSPH16B antikoerper, Sis1 antikoerper, CG10578 antikoerper, DNAJ-1 antikoerper, DNAJ1 antikoerper, DROJ1 antikoerper, Dmel\\CG10578 antikoerper, DnaJ1 64EF antikoerper, DroJ1 antikoerper, EU3500 antikoerper, HSP40 antikoerper, HSP40/HDJ1 antikoerper, Hsp-40 antikoerper, anon-WO0140519.166 antikoerper, anon-WO0172774.135 antikoerper, dHDJ1 antikoerper, dHDJ1/HSP40 antikoerper, dHdj1 antikoerper, dhdJ1 antikoerper, dhdj-1 antikoerper, dhdj1 antikoerper, dnaJ-1 antikoerper, droj1 antikoerper, hsp40 antikoerper, dnajb4 antikoerper, hdj1 antikoerper, hspf1 antikoerper, sis1 antikoerper, DnaJ-5 antikoerper, MAS5 antikoerper, dnaJ antikoerper, 0610007I11Rik antikoerper, dnajb1 antikoerper, zf-Hsp40 antikoerper, zgc:101068 antikoerper, DnaJ heat shock protein family (Hsp40) member B1 antikoerper, DnaJ-like-1 antikoerper, DnaJ (Hsp40) homolog 5 antikoerper, type I HSP40 co-chaperone YDJ1 antikoerper, DnaJ protein antikoerper, molecular chaperone DnaJ antikoerper, DnaJ (Hsp40) homolog, subfamily B, member 1a antikoerper, DNAJB1 antikoerper, Dnajb1 antikoerper, DnaJ-1 antikoerper, dnajb1 antikoerper, DnaJ-5 antikoerper, YDJ1 antikoerper, dnaJ antikoerper, dnajb1a antikoerper

Hintergrund: DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Molekulargewicht: 38 kDa (MW of target protein)