EIF4ENIF1 Antikörper (N-Term)
-
- Target Alle EIF4ENIF1 Antikörper anzeigen
- EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 (EIF4ENIF1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF4ENIF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF4 ENIF1 antibody was raised against the N terminal of EIF4 NIF1
- Aufreinigung
- Affinity purified
- Immunogen
- EIF4 ENIF1 antibody was raised using the N terminal of EIF4 NIF1 corresponding to a region with amino acids TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI
- Top Product
- Discover our top product EIF4ENIF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF4ENIF1 Blocking Peptide, catalog no. 33R-9031, is also available for use as a blocking control in assays to test for specificity of this EIF4ENIF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 NIF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1 (EIF4ENIF1))
- Andere Bezeichnung
- EIF4ENIF1 (EIF4ENIF1 Produkte)
- Synonyme
- RGD1560908 antikoerper, eif4enif1 antikoerper, MGC80355 antikoerper, EIF4ENIF1 antikoerper, wu:fd15a05 antikoerper, zgc:101646 antikoerper, MGC147579 antikoerper, 4E-T antikoerper, Clast4 antikoerper, 2610509L04Rik antikoerper, A930019J01Rik antikoerper, AA410001 antikoerper, AU021239 antikoerper, D11Ertd166e antikoerper, eukaryotic translation initiation factor 4E nuclear import factor 1 antikoerper, eukaryotic translation initiation factor 4E nuclear import factor 1 S homeolog antikoerper, Eif4enif1 antikoerper, EIF4ENIF1 antikoerper, eif4enif1.S antikoerper, eif4enif1 antikoerper
- Hintergrund
- The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic, its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 108 kDa (MW of target protein)
-