LETM2 Antikörper (N-Term)
-
- Target Alle LETM2 Antikörper anzeigen
- LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LETM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LETM2 antibody was raised against the N terminal of LETM2
- Aufreinigung
- Affinity purified
- Immunogen
- LETM2 antibody was raised using the N terminal of LETM2 corresponding to a region with amino acids KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK
- Top Product
- Discover our top product LETM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LETM2 Blocking Peptide, catalog no. 33R-4578, is also available for use as a blocking control in assays to test for specificity of this LETM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))
- Andere Bezeichnung
- LETM2 (LETM2 Produkte)
- Synonyme
- 6030453H13 antikoerper, D030041N04Rik antikoerper, LETM2S antikoerper, leucine zipper and EF-hand containing transmembrane protein 2 antikoerper, leucine zipper-EF-hand containing transmembrane protein 2 antikoerper, LETM2 antikoerper, Letm2 antikoerper
- Hintergrund
- LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.
- Molekulargewicht
- 45 kDa (MW of target protein)
-