SS18L1 Antikörper (Middle Region)

Produktnummer ABIN632142

Produktdetails anti-SS18L1 Antikörper

Target: SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SS18L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SS18 L1 antibody was raised against the middle region of SS18 1

Aufreinigung: Affinity purified

Immunogen: SS18 L1 antibody was raised using the middle region of SS18 1 corresponding to a region with amino acids EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SS18L1 Blocking Peptide, catalog no. 33R-2833, is also available for use as a blocking control in assays to test for specificity of this SS18L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SS10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SS18L1

Target: SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))

Andere Bezeichnung: SS18L1 (SS18L1 Produkte)

Synonyme: crest antikoerper, CREST antikoerper, LP2261 antikoerper, A230053O16Rik antikoerper, SS18L1, nBAF chromatin remodeling complex subunit antikoerper, synovial sarcoma translocation gene on chromosome 18-like 1 antikoerper, synovial sarcoma translocation gene on chromosome 18-like 1 S homeolog antikoerper, SS18, nBAF chromatin remodeling complex subunit like 1 antikoerper, SS18L1 antikoerper, ss18l1 antikoerper, ss18l1.S antikoerper, Ss18l1 antikoerper

Hintergrund: Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X,18)(p11.2,q11.2), in which the 5-prime end of the SS18 gene is fused in-frame to the 3-prime end of the SSX1, SSX2, or SSX4 gene. The SS18L1 gene is homologous to SS18.

Molekulargewicht: 43 kDa (MW of target protein)