RAI14 Antikörper (Middle Region)

Produktnummer ABIN632115

Produktdetails anti-RAI14 Antikörper

Target: RAI14 (Retinoic Acid Induced 14 (RAI14))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAI14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAI14 antibody was raised against the middle region of RAI14

Aufreinigung: Affinity purified

Immunogen: RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAI14 Blocking Peptide, catalog no. 33R-5446, is also available for use as a blocking control in assays to test for specificity of this RAI14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAI14

Target: RAI14 (Retinoic Acid Induced 14 (RAI14))

Andere Bezeichnung: RAI14 (RAI14 Produkte)

Synonyme: RAI14 antikoerper, NORPEG antikoerper, RAI13 antikoerper, 1700008J19Rik antikoerper, 1700020L11Rik antikoerper, Ankycorbin antikoerper, Norpeg antikoerper, mKIAA1334 antikoerper, retinoic acid induced 14 antikoerper, ankycorbin antikoerper, RAI14 antikoerper, rai14 antikoerper, LOC100541535 antikoerper, Rai14 antikoerper

Hintergrund: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Molekulargewicht: 110 kDa (MW of target protein)