ASPHD2 Antikörper (Middle Region)

Produktnummer ABIN632104

Produktdetails anti-ASPHD2 Antikörper

Target: ASPHD2 (Aspartate beta-Hydroxylase Domain Containing 2 (ASPHD2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASPHD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ASPHD2 antibody was raised against the middle region of ASPHD2

Aufreinigung: Affinity purified

Immunogen: ASPHD2 antibody was raised using the middle region of ASPHD2 corresponding to a region with amino acids YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASPHD2 Blocking Peptide, catalog no. 33R-10060, is also available for use as a blocking control in assays to test for specificity of this ASPHD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPHD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASPHD2

Target: ASPHD2 (Aspartate beta-Hydroxylase Domain Containing 2 (ASPHD2))

Andere Bezeichnung: ASPHD2 (ASPHD2 Produkte)

Synonyme: 2900006N09Rik antikoerper, 9230106G13Rik antikoerper, RGD1306020 antikoerper, zgc:153516 antikoerper, aspartate beta-hydroxylase domain containing 2 antikoerper, ASPHD2 antikoerper, asphd2 antikoerper, Asphd2 antikoerper

Hintergrund: The function of ASPH protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)