CES2 Antikörper

Produktnummer ABIN632102

Der Kaninchen Polyklonal anti-CES2 Antikörper wird verwendet zum Nachweis von CES2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CES2 Antikörper (ABIN632102)

Target: CES2 (Carboxylesterase 2 (CES2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CES2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CES2 Antikörper

Aufreinigung: Affinity purified

Immunogen: Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxylesterase 2 Blocking Peptide, (ABIN939260), is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CES2

Target: CES2 (Carboxylesterase 2 (CES2))

Andere Bezeichnung: Carboxylesterase 2

Hintergrund: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined, however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.

Molekulargewicht: 69 kDa (MW of target protein)