CES2 Antikörper

Produktnummer ABIN632102

Produktdetails anti-CES2 Antikörper

Target: CES2 (Carboxylesterase 2 (CES2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CES2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxylesterase 2 Blocking Peptide, catalog no. 33R-3874, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CES2

Target: CES2 (Carboxylesterase 2 (CES2))

Andere Bezeichnung: Carboxylesterase 2 (CES2 Produkte)

Synonyme: CE-2 antikoerper, CES2A1 antikoerper, PCE-2 antikoerper, iCE antikoerper, Ces2 antikoerper, im:6908784 antikoerper, si:dkey-38l12.2 antikoerper, zgc:153863 antikoerper, ce-2 antikoerper, ces2a1 antikoerper, pce-2 antikoerper, carboxylesterase 2 antikoerper, liver carboxylesterase 2 antikoerper, cocaine esterase antikoerper, carboxylesterase 2 (intestine, liver) antikoerper, CES2 antikoerper, Ces2 antikoerper, LOC100343300 antikoerper, LOC100734360 antikoerper, ces2 antikoerper

Hintergrund: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined, however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.

Molekulargewicht: 69 kDa (MW of target protein)