PSMB6 Antikörper

Produktnummer ABIN632097

Produktdetails anti-PSMB6 Antikörper

Target: PSMB6 (Proteasome (Prosome, Macropain) Subunit, beta Type, 6 (PSMB6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMB6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMB6 Blocking Peptide, catalog no. 33R-9319, is also available for use as a blocking control in assays to test for specificity of this PSMB6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMB6

Target: PSMB6 (Proteasome (Prosome, Macropain) Subunit, beta Type, 6 (PSMB6))

Andere Bezeichnung: PSMB6 (PSMB6 Produkte)

Synonyme: Lmp19 antikoerper, Mpnd antikoerper, Psmb6l antikoerper, DELTA antikoerper, LMPY antikoerper, Y antikoerper, y antikoerper, zgc:109823 antikoerper, proteasome (prosome, macropain) subunit, beta type 6 antikoerper, proteasome subunit beta 6 antikoerper, Psmb6 antikoerper, PSMB6 antikoerper, psmb6 antikoerper

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA