FAM54A Antikörper (Middle Region)

Produktnummer ABIN632084

Produktdetails anti-FAM54A Antikörper

Target: FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM54A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM54 A antibody was raised against the middle region of FAM54

Aufreinigung: Affinity purified

Immunogen: FAM54 A antibody was raised using the middle region of FAM54 corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM54A Blocking Peptide, catalog no. 33R-6748, is also available for use as a blocking control in assays to test for specificity of this FAM54A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM54A

Target: FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))

Andere Bezeichnung: FAM54A (FAM54A Produkte)

Synonyme: FAM54A antikoerper, DUFD1 antikoerper, 2610016C23Rik antikoerper, 4933412C16Rik antikoerper, Dufd1 antikoerper, Fam54a antikoerper, mitochondrial fission regulator 2 antikoerper, MTFR2 antikoerper, Mtfr2 antikoerper

Hintergrund: FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.

Molekulargewicht: 43 kDa (MW of target protein)