FAM54A Antikörper (Middle Region)
-
- Target Alle FAM54A Antikörper anzeigen
- FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM54A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM54 A antibody was raised against the middle region of FAM54
- Aufreinigung
- Affinity purified
- Immunogen
- FAM54 A antibody was raised using the middle region of FAM54 corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
- Top Product
- Discover our top product FAM54A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM54A Blocking Peptide, catalog no. 33R-6748, is also available for use as a blocking control in assays to test for specificity of this FAM54A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))
- Andere Bezeichnung
- FAM54A (FAM54A Produkte)
- Synonyme
- FAM54A antikoerper, DUFD1 antikoerper, 2610016C23Rik antikoerper, 4933412C16Rik antikoerper, Dufd1 antikoerper, Fam54a antikoerper, mitochondrial fission regulator 2 antikoerper, MTFR2 antikoerper, Mtfr2 antikoerper
- Hintergrund
- FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.
- Molekulargewicht
- 43 kDa (MW of target protein)
-