CNOT11 Antikörper (Middle Region)
-
- Target Alle CNOT11 Antikörper anzeigen
- CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CNOT11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C2 ORF29 antibody was raised against the middle region of C2 rf29
- Aufreinigung
- Affinity purified
- Immunogen
- C2 ORF29 antibody was raised using the middle region of C2 rf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI
- Top Product
- Discover our top product CNOT11 Primärantikörper
-
anti-CCR4-NOT Transcription Complex, Subunit 11 (CNOT11) (AA 143-192) antibody
CNOT11 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Schwein, Fledermaus, Hamster, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-CCR4-NOT Transcription Complex, Subunit 11 (CNOT11) (AA 215-264) antibodyCNOT11 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Schwein, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Hamster, Affe, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C2ORF29 Blocking Peptide, catalog no. 33R-8905, is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))
- Andere Bezeichnung
- C2ORF29 (CNOT11 Produkte)
- Synonyme
- C2orf29 antikoerper, 2410015L18Rik antikoerper, C40 antikoerper, D1Bwg0212e antikoerper, RGD1560909 antikoerper, fj49e01 antikoerper, wu:fj49e01 antikoerper, zgc:163002 antikoerper, CCR4-NOT transcription complex subunit 11 antikoerper, CCR4-NOT transcription complex, subunit 11 antikoerper, CNOT11 antikoerper, Cnot11 antikoerper, cnot11 antikoerper
- Hintergrund
- The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 55 kDa (MW of target protein)
-
