NDUFS1 Antikörper (Middle Region)

Produktnummer ABIN632032

Produktdetails anti-NDUFS1 Antikörper

Target: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDUFS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NDUFS1 antibody was raised against the middle region of NDUFS1

Aufreinigung: Affinity purified

Immunogen: NDUFS1 antibody was raised using the middle region of NDUFS1 corresponding to a region with amino acids TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDUFS1 Blocking Peptide, catalog no. 33R-9227, is also available for use as a blocking control in assays to test for specificity of this NDUFS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDUFS1

Target: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Andere Bezeichnung: NDUFS1 (NDUFS1 Produkte)

Synonyme: 5830412M15Rik antikoerper, 9930026A05Rik antikoerper, CI-75Kd antikoerper, CI-75k antikoerper, PRO1304 antikoerper, NADH dehydrogenase (ubiquinone) Fe-S protein 1 antikoerper, NADH:ubiquinone oxidoreductase core subunit S1 antikoerper, Ndufs1 antikoerper, NDUFS1 antikoerper

Hintergrund: The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Molekulargewicht: 77 kDa (MW of target protein)