ASPRV1 Antikörper (Middle Region)
-
- Target Alle ASPRV1 Antikörper anzeigen
- ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASPRV1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SASP antibody was raised against the middle region of Sasp
- Aufreinigung
- Affinity purified
- Immunogen
- SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM
- Top Product
- Discover our top product ASPRV1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SASP Blocking Peptide, catalog no. 33R-7921, is also available for use as a blocking control in assays to test for specificity of this SASP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SASP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))
- Andere Bezeichnung
- SASP (ASPRV1 Produkte)
- Synonyme
- MUNO antikoerper, SASP antikoerper, SASPase antikoerper, Taps antikoerper, 2300003P22Rik antikoerper, AA986851 antikoerper, RGD1560859 antikoerper, aspartic peptidase retroviral like 1 antikoerper, aspartic peptidase, retroviral-like 1 antikoerper, ASPRV1 antikoerper, Asprv1 antikoerper
- Hintergrund
- The specific function of SASP is not yet known.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis, Cell RedoxHomeostasis
-