ASPRV1 Antikörper (Middle Region)

Produktnummer ABIN632022

Produktdetails anti-ASPRV1 Antikörper

Target: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASPRV1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SASP antibody was raised against the middle region of Sasp

Aufreinigung: Affinity purified

Immunogen: SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SASP Blocking Peptide, catalog no. 33R-7921, is also available for use as a blocking control in assays to test for specificity of this SASP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SASP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASPRV1

Target: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Andere Bezeichnung: SASP (ASPRV1 Produkte)

Synonyme: MUNO antikoerper, SASP antikoerper, SASPase antikoerper, Taps antikoerper, 2300003P22Rik antikoerper, AA986851 antikoerper, RGD1560859 antikoerper, aspartic peptidase retroviral like 1 antikoerper, aspartic peptidase, retroviral-like 1 antikoerper, ASPRV1 antikoerper, Asprv1 antikoerper

Hintergrund: The specific function of SASP is not yet known.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cell RedoxHomeostasis