TPD52L3 Antikörper (Middle Region)
-
- Target Alle TPD52L3 Antikörper anzeigen
- TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TPD52L3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TPD52 L3 antibody was raised against the middle region of TPD52 3
- Aufreinigung
- Affinity purified
- Immunogen
- TPD52 L3 antibody was raised using the middle region of TPD52 3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS
- Top Product
- Discover our top product TPD52L3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TPD52L3 Blocking Peptide, catalog no. 33R-3418, is also available for use as a blocking control in assays to test for specificity of this TPD52L3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD50 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))
- Andere Bezeichnung
- TPD52L3 (TPD52L3 Produkte)
- Synonyme
- NYDSP25 antikoerper, hD55 antikoerper, 4931412G03Rik antikoerper, Trpd52l3 antikoerper, RGD1309391 antikoerper, TPD52L3 antikoerper, TRPD52L3 antikoerper, tumor protein D52 like 3 antikoerper, tumor protein D52-like 3 antikoerper, TPD52L3 antikoerper, Trpd52l3 antikoerper, Tpd52l3 antikoerper
- Hintergrund
- TPD52L3 encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.
- Molekulargewicht
- 15 kDa (MW of target protein)
-