TPD52L3 Antikörper (Middle Region)

Produktnummer ABIN632010

Produktdetails anti-TPD52L3 Antikörper

Target: TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPD52L3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TPD52 L3 antibody was raised against the middle region of TPD52 3

Aufreinigung: Affinity purified

Immunogen: TPD52 L3 antibody was raised using the middle region of TPD52 3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPD52L3 Blocking Peptide, catalog no. 33R-3418, is also available for use as a blocking control in assays to test for specificity of this TPD52L3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD50 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPD52L3

Target: TPD52L3 (Tumor Protein D52-Like 3 (TPD52L3))

Andere Bezeichnung: TPD52L3 (TPD52L3 Produkte)

Synonyme: NYDSP25 antikoerper, hD55 antikoerper, 4931412G03Rik antikoerper, Trpd52l3 antikoerper, RGD1309391 antikoerper, TPD52L3 antikoerper, TRPD52L3 antikoerper, tumor protein D52 like 3 antikoerper, tumor protein D52-like 3 antikoerper, TPD52L3 antikoerper, Trpd52l3 antikoerper, Tpd52l3 antikoerper

Hintergrund: TPD52L3 encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.

Molekulargewicht: 15 kDa (MW of target protein)